NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193695_1000001

Scaffold Ga0193695_1000001


Overview

Basic Information
Taxon OID3300021418 Open in IMG/M
Scaffold IDGa0193695_1000001 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)665428
Total Scaffold Genes684 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)454 (66.37%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9137Long. (o)-106.8949Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014806Metagenome / Metatranscriptome260Y
F020394Metagenome / Metatranscriptome224Y
F020629Metagenome / Metatranscriptome223Y
F045738Metagenome / Metatranscriptome152Y

Sequences

Protein IDFamilyRBSSequence
Ga0193695_1000001492F014806GAGMGHVLAAAFVLADAATEGKKVITGMLIAGLVLAAGPILGETYMYFKYHRRGRSPH
Ga0193695_1000001509F020629N/AVQWLAVMVTVLVVGTIIGLIWADTSNIAGSIAVVTNIVGGAGTAFFLIALAVVTRRQRRA
Ga0193695_1000001665F045738GGAGGVTFYERFEKLSATDMSTSTSTRRRLLERAGKASLGVAFVLAGLSRSGKAGAATKGAGCCSLAYQNQCPNCNGHGYDCAGGCTRWAWYCVDGSHRVWICGECYSGGGCQGCSCGAVALTQTSRPILRP
Ga0193695_1000001667F020394N/AVVVGDLASPEEPICVVTRIIFGRWSSLAGAFLRFRRLRRIGRRTIPGLIDVHVRIGRNATLTIISLWQDELSLLQFTTLEPHVQAVRWTIDKQGEIWSGVFRLAGTSSMSKPWIGTIRHWEPLGMSSAESVAVDEP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.