NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213866_10024308

Scaffold Ga0213866_10024308


Overview

Basic Information
Taxon OID3300021425 Open in IMG/M
Scaffold IDGa0213866_10024308 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3575
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (18.18%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056150Metagenome138N
F073424Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0213866_100243081F073424GAGMKLTPKEIKEQKAKFGSKAVNYFVRFMDAKRKWKRLPDYFIKQVIE
Ga0213866_100243086F056150N/AMDRKLIKKIENFIFWIGREYNVVELEDFKQDIFIILLNKGEDFIIQLDKENSIKKYVYKLCLYQIISERGQYRTKYYLPSQFSSIEDIETYSNSCFKDDVLKDLIDSLDGLDKIMMEQLLICSGNRNCLAEKSDIHRNTIQYKFKELANKIKQKWTLNEFYS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.