Basic Information | |
---|---|
Taxon OID | 3300021433 Open in IMG/M |
Scaffold ID | Ga0210391_10108105 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2191 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Massachusetts | |||||||
Coordinates | Lat. (o) | 42.481016 | Long. (o) | -72.178343 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000321 | Metagenome / Metatranscriptome | 1304 | Y |
F013723 | Metagenome / Metatranscriptome | 269 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210391_101081051 | F013723 | GGA | VGAGKTTFYEAYLKEPFPTLVPALRHQQQPFLEERRSFAVEDIRVDTQLLDQAKAAGYSTKVLFIS |
Ga0210391_101081052 | F000321 | N/A | MGRDISPVVATPSGRQKGIVTNRRSVQFGVYNVRLLSALDRLLRDKPRYIGELSTSINDALLAVDLNTVELVTLQSRQKQTGRETQVVILNRLRKRIHQVAKKRNCSMNQLVNSALLAFYSKGGESKLKEPAKGRGSSVHSYDSMSELERRELHQMLSGLSALQSVPIDAEEPDGTYYEYDRNLKATVKVTPDGERTPVSKLETSFEPTRRKGARKIVHEEIAS |
⦗Top⦘ |