NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213920_1050318

Scaffold Ga0213920_1050318


Overview

Basic Information
Taxon OID3300021438 Open in IMG/M
Scaffold IDGa0213920_1050318 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)868
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9255Long. (o)-83.5226Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000821Metagenome / Metatranscriptome876Y
F001477Metagenome / Metatranscriptome687Y
F003212Metagenome / Metatranscriptome500Y

Sequences

Protein IDFamilyRBSSequence
Ga0213920_10503182F001477AGGAGGMSNVYTIHPPKSDLILFYEVIEPNNANTWGGEDATSAIQWLSLAPTGSRILVSAWDSDEEDAHLVGQTIDITDIVRAASL
Ga0213920_10503183F000821GGAGMNQEYLQAKFDLCINQAEKNIKEEEIAEAIKNLRRANSALSQLFGFEQEGDNE
Ga0213920_10503184F003212GGAGMKDKWLVTIEIDTYDGDPKGWDWSYYFLSDEVKVISSEFKGRVLLTEGEGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.