NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213878_10137779

Scaffold Ga0213878_10137779


Overview

Basic Information
Taxon OID3300021444 Open in IMG/M
Scaffold IDGa0213878_10137779 Open in IMG/M
Source Dataset NameVellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1008
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location NameBrazil: Minas Gerais
CoordinatesLat. (o)-19.28Long. (o)-43.5919Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044976Metagenome153Y
F046534Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0213878_101377792F046534GAGMNHSTSDDSDIGTGGLPLNPVSSLTDLQVKAYENRVRERLMAKYPALTRTEARRVEEQIQKLVQIYAEGRHFLHGDSTDCIRQNHHPQGIEPTREIEITDERE
Ga0213878_101377793F044976GAGMNGNSRQPRVPTLKDLYGTKQSSLPWEEQQAEIVRFWTDSGDCWGFLFHHVSGTFYGARDQRLLIDWPLGTIVIAGPKTLEFYEQFSNHRATLIRADGKDILSVKMHLNSEGLAEKDAKVVTSEVGSEDLSL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.