Scaffold Ga0190360_1201981

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0190360_1201981

Scaffold Ga0190360_1201981

Overview

Basic Information
Taxon OID	3300021468 Open in IMG/M
Scaffold ID	Ga0190360_1201981 Open in IMG/M
Source Dataset Name	Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-3-4_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	624
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location Name	Mexico: Guaymas Basin
Coordinates	Lat. (^o)	27.0114	Long. (^o)	-110.5956	Alt. (m)		Depth (m)	2011
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102256	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0190360_12019812	F102256	AGAAG	MGREKINVYSCRNCYLEFYYENHITHCPFCGNKLKWIGRIQENEIEGPIYTLRYSTGEKMQKKIEEEEAIKEAEESWYLWEE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.