Scaffold Ga0190307_1002374

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0190307_1002374

Scaffold Ga0190307_1002374

Overview

Basic Information
Taxon OID	3300021502 Open in IMG/M
Scaffold ID	Ga0190307_1002374 Open in IMG/M
Source Dataset Name	Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-4-5_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4772
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location Name	Mexico: Guaymas Basin
Coordinates	Lat. (^o)	27.0114	Long. (^o)	-110.5931	Alt. (m)		Depth (m)	1999
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046123	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190307_10023742	F046123	GAGG	MPCPYKEGSEMCWLCWYWIEAEEKCIFDEGDAEREFLLIDEFKDIDPQTYKERIEWIKGLGLMHLYRAVKAGMVKEQRTLSDFGLAVMSHE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.