NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210409_10356085

Scaffold Ga0210409_10356085


Overview

Basic Information
Taxon OID3300021559 Open in IMG/M
Scaffold IDGa0210409_10356085 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1314
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003832Metagenome / Metatranscriptome466Y
F005268Metagenome / Metatranscriptome406Y
F025325Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0210409_103560852F003832N/AVRETIKSAAKQLRTQANWPPEEGQIISFKSSTGSETTILKEVRWGLVWRDFILQDGRVIPEHRISGCPQPQVWRKVDEVTDNEREECEERLLSMAGAGMDPRQRDQPFWAELNQYLAYTYLRYKQAA
Ga0210409_103560853F005268GAGGVSRSDEETEEQQAWRVLSEAGLVEIRLDEFAERIRDVKRIVIIRLRELLDFNTGIKERESAAYSLGTLAGLELKVLANAAKPPDPSEM
Ga0210409_103560854F025325AGGAGGMPSDGPNRLKKTWEELTAAASMETDPEKLGTILEEILAALEERQRTQYGGSRSCG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.