NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126371_10004827

Scaffold Ga0126371_10004827


Overview

Basic Information
Taxon OID3300021560 Open in IMG/M
Scaffold IDGa0126371_10004827 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11917
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000174Metagenome / Metatranscriptome1764Y
F012384Metagenome / Metatranscriptome281Y
F015641Metagenome / Metatranscriptome253Y

Sequences

Protein IDFamilyRBSSequence
Ga0126371_100048271F015641AGGAGMSSPDSKARARAELIELLGSQLNTLEKETFGVVTEGELCEYDERSDRIRQLYAEVIDDREAAT
Ga0126371_1000482711F012384AGGAGLPETESSLPRRWTVIASGLLLFALALVVIYSSNNAFHSPIAVVVLAAIGLVAVLLQVRLRQSASGMRRIPQLLNVIGIVCAVAALFADRFGLASTLAEATALAAVGCFGISSVIVLDSLRNKDRTTAK
Ga0126371_1000482713F000174AGGAVYEVLRQKELELARLEKEVEALRVVAPLLSPEDSKDIGVDAPKPTLATQTTQQPIRIPQAAVNQNPQPARAAGWEETAKRWP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.