NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126371_11688694

Scaffold Ga0126371_11688694


Overview

Basic Information
Taxon OID3300021560 Open in IMG/M
Scaffold IDGa0126371_11688694 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)757
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003418Metagenome / Metatranscriptome488Y
F025580Metagenome201Y
F061609Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0126371_116886941F003418N/AEEIHLGEHATNCYFDGSGLYVTATRSPDIEASERTGSFWRVDTDTTGLDLIPGQLS
Ga0126371_116886942F061609GGAMKRDKRSFRVAMMADRYVNAAPGGVDGVAAAEEAGWGVLQLPPDDYPADLVKLLLFEVAEQAEEFSRRGYDLVLVGRHDGLAEALAGVGLPLPDSSMPLTTAELVDFFGARPIPRAMAELGELAGD
Ga0126371_116886943F025580N/AGVTITSSDPTRGGRPEWPEGTLEHVNGEGIYIEELRKALESRGLRFPRVAGETHATEGHDENAERAALEATLDRQS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.