Scaffold Ga0226832_10224760

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0226832_10224760

Scaffold Ga0226832_10224760

Overview

Basic Information
Taxon OID	3300021791 Open in IMG/M
Scaffold ID	Ga0226832_10224760 Open in IMG/M
Source Dataset Name	Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	742
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location
Location Name	Daikoku vent field, Mariana back arc basin
Coordinates	Lat. (^o)	21.3250983	Long. (^o)	144.19162955	Alt. (m)		Depth (m)	409.13
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043989	Metagenome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0226832_102247602	F043989	N/A	MIKYVFYIIIIWSLFGSSCSRGKGNLPWHPPEFAPIYREECYSDHKNFLCMDKEKEASYTSPFLYFLFIGGTNDPDSL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.