NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063126_1001912

Scaffold Ga0063126_1001912


Overview

Basic Information
Taxon OID3300021883 Open in IMG/M
Scaffold IDGa0063126_1001912 Open in IMG/M
Source Dataset NameMetatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S0 C1 B9 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1464
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)28.999982Long. (o)-14.999994Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000371Metagenome / Metatranscriptome1220Y
F031000Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Ga0063126_10019121F031000N/ATRRPVVNELIGKGKVLLENPDKPKFLEGHVQRIILGWDDTKNKATERLTLLQNTKAAWVGYYAGLENIAVEFDKAEEEIKKVKKRFNLQSAFEDLERRQKIFAATKGTIDGMWNQLNKDFDTMTKTLPEDKKDFVKKEVKAVSEKLPVVGRFEEKVVKIETFVGRLNEFDKSLKAIDAWMLGAEESLNNVKTKSDTMTPEDRVSTTMELSEDVEAKVATIKKNNAEELELLPQGDKVPQDAQDHKE
Ga0063126_10019122F000371GAGGLSFYLKVTKSHRTHKITKNELKRIETFVLELQKKVQETCDHFSEDVKYWAQYKTGIRSFMPWLTGAEAKSGEGLTKPQTLDEANAMFAAVSSFDGACLKHIKLLQEAADAANKMTTHKEADDEVAALKERYSKVKAISDEWMKKADTLVKEWKLLDNTVTELNSWVAKDRDEDGQQSFSLEKMESTLGELKNIFKEKEKLVENL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.