NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063119_1008716

Scaffold Ga0063119_1008716


Overview

Basic Information
Taxon OID3300021901 Open in IMG/M
Scaffold IDGa0063119_1008716 Open in IMG/M
Source Dataset NameMetatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-12 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1179
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-4.668Long. (o)-7.06118Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020701Metagenome / Metatranscriptome222Y

Sequences

Protein IDFamilyRBSSequence
Ga0063119_10087161F020701N/AGKDYTQLFHTSSHPSIIIMSEIESQNTSVEVPEQTAFNKSFRPIIGTCLAISALAAMALTSSPSGAVNPGKPIASTTQLEVVKQGKQPIKDGCANIYGSDPDQVFIDPDTGLRVLTAVFTICDDRSLNGVALDSLGFDHQNDIDIGLTYVETGPGCWLTLYDGPNFNGKTAVISPETSMHLKHVGARNWNDLTRSITTRSSTGDGVALYLSHRVALGSVNDHCVAMYNANPEIFPKADGLYLCGDKNAAKTWNFDLADIIEQGFNIDGSHFGIKYLMSGRKVKLSVFDGPTRNTVSHGPLEMSGHETLDLETVKYGDDHWDSKAKSFTLVEV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.