NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063131_1006022

Scaffold Ga0063131_1006022


Overview

Basic Information
Taxon OID3300021904 Open in IMG/M
Scaffold IDGa0063131_1006022 Open in IMG/M
Source Dataset NameMetatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1402
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)34.719725Long. (o)-14.260068Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044860Metagenome / Metatranscriptome153Y
F063388Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0063131_10060221F044860N/AFARPREWKLRVFSLPVTMVRLLHLVLVGALAVSPVQKVIQLLDELKGKVESDLANEEKLMEEYTTWCDEEANTKEDAITSSKRTIGDLEATIEDAKGSIVTLTSSIDELTMSISTSEAELDKATKLRNKENDDFMASEKELVDTVDSLERAITVLKKNLGFLQNGRVSEALGASLSGLRKVVEASWVNAHQKSVLTSLLQAHENDEDEQPQGTTVAYESASGGILDTIADMQSKAEESLSSTRKDEMEAAHAFAMLKQGLEDEIKVNKKQLGEATLTRSTTEEEHSQRRDRFDGDEGNARCG
Ga0063131_10060222F063388GAGLTETKETLAADEKTLAEVKTDCEAKAKEWAMRQKQAGEETAAIEKAKEVLAEGVKVFLQTSTKLRVKSADEAYDTRAQVVRVLSKISQKAHSYKLMQLVASARSDPFGKIRGLIEDMIAKLTKEAAEEADQKSFCDEEISESKAKQADLSGKLDKTSARIAKADADKAKLLEEIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.