Scaffold Ga0063092_1053211

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063092_1053211

Scaffold Ga0063092_1053211

Overview

Basic Information
Taxon OID	3300021936 Open in IMG/M
Scaffold ID	Ga0063092_1053211 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-15M (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	561
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium catenella	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location Name	Arctic Ocean
Coordinates	Lat. (^o)	73.0188	Long. (^o)	9.8566	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010594	Metagenome / Metatranscriptome	301	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063092_10532111	F010594	N/A	KAKIAELESSMGAGAAKIAELKEKRKETLDEVNADHKALSDATGMRMKENKEFQASETDYIEAISASKNAIVVLGKHNPSLAQLRSAAHTLLDARMTQMVDSSKAGKANVGMLRSFLHNTESATSFLAIPGMQSYAPQSGQIFGILGQMKEDFEVNLSEAQKSEAKSLSEFETLKAAKEDELATGR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.