NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222717_10005077

Scaffold Ga0222717_10005077


Overview

Basic Information
Taxon OID3300021957 Open in IMG/M
Scaffold IDGa0222717_10005077 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_18D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9572
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (12.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.0966Long. (o)-122.4216Alt. (m)Depth (m)38
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030770Metagenome / Metatranscriptome184Y
F032285Metagenome / Metatranscriptome180Y
F041241Metagenome / Metatranscriptome160Y
F061854Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0222717_1000507719F041241N/AMKLSFRTRTSYSITQVGEPCTLKSEDFVKAVPPYKGETEEDFWNYINDNLSDWEAEEYIEDNEGILSEELLDTLYKSFVDYPTDVMFDSRNKSDEITMDGGELDEEYTKWNGFNVKYSNN
Ga0222717_1000507724F061854N/AMFKKVKSKLLTYLFTDWVNNEKDVETLMLTQQMIDIQKNKITGHTPIIGFRQQRVDGSIS
Ga0222717_1000507727F030770N/AMINTEKPKVVKPWSNEMYDWNDKVSDLMKAEIKVQIEKNKDDFDKLNELVTLCGGIKFGDGYEIDELYDECLKELENVQNYWLNEEWDWSVKQGIVTDCIKIDFVGY
Ga0222717_100050778F032285N/AMKWEAVHISDKIHWLKDVVMNSTNYKDGDEVIINALITGSNNTFSGEMGFEIQPHHMKFMRELWDEHIETQKDNSIITKLREKS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.