Basic Information | |
---|---|
Taxon OID | 3300021960 Open in IMG/M |
Scaffold ID | Ga0222715_10223161 Open in IMG/M |
Source Dataset Name | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1113 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 38.0566 | Long. (o) | -122.185 | Alt. (m) | Depth (m) | 29 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057302 | Metagenome | 136 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0222715_102231611 | F057302 | N/A | GDTEMEIEGLTQKEIVKAQFDALSRLGDERTYAQNLLYDKVRREHLSNLHMQGLESLYTSRPFTEHARKIMRTQAVEFMANVYGVEL |
⦗Top⦘ |