NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222714_10285243

Scaffold Ga0222714_10285243


Overview

Basic Information
Taxon OID3300021961 Open in IMG/M
Scaffold IDGa0222714_10285243 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_3D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)911
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.0516Long. (o)-121.88Alt. (m)Depth (m)13
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007859Metagenome / Metatranscriptome343Y
F008688Metagenome / Metatranscriptome329N
F010081Metagenome / Metatranscriptome308Y

Sequences

Protein IDFamilyRBSSequence
Ga0222714_102852431F008688N/AMNRFNKIMLGSLAAILLTAMTVEPPKIKVYLIMSYRSSDLTIEKVYLKKENAEKYRDMYKESHNYSVEERELTE
Ga0222714_102852432F007859GAGMKNLLIIALLCTGCTSGMYLRYSYNRALESLPPCSRVHAINNNYITYSMIENSTNSVYTVYTNYYRAYYNCDGKIINTTKN
Ga0222714_102852433F010081N/AMKEQIDSIIKKHCLKMQEVDKNKSIPMTVKDLDHIVYEMYRELYGLRDIRASNYNLNSFTADDKKGHCC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.