NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0232639_1283386

Scaffold Ga0232639_1283386


Overview

Basic Information
Taxon OID3300021977 Open in IMG/M
Scaffold IDGa0232639_1283386 Open in IMG/M
Source Dataset NameHydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmer
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)635
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → unclassified Colwelliaceae → Colwelliaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location
Location NameHafa Adai vent field, Mariana back arc basin
CoordinatesLat. (o)16.96173128Long. (o)144.86920936Alt. (m)Depth (m)3278
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034708Metagenome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0232639_12833862F034708GGAGMDKLKLKSGREIGIKDISLDERDEMLDSVEYIYDDKGVVSGVKMMHSTITKWLRFGLNGKADDAYILGLSLEERTEIFLAMQEKLLTGEGNASSSK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.