NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196883_1000284

Scaffold Ga0196883_1000284


Overview

Basic Information
Taxon OID3300022050 Open in IMG/M
Scaffold IDGa0196883_1000284 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5319
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.12Long. (o)-75.25Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010091Metagenome / Metatranscriptome308Y
F030441Metagenome / Metatranscriptome185Y
F037248Metagenome / Metatranscriptome168Y
F040134Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0196883_10002841F030441AGGAMNNNVDLLSPFPQEIVRKAPAGKFGDYVPHAHYVERLRDSGVTYTWACEPVYGTYNGEKRIVGAKGTITIEGMGSYDGFGDVDTFKLGNAKFNDGTNLK
Ga0196883_10002842F040134AGGMYSMKDLIVKSKWKLSSIEYSGLGDKPYFILNNDQGETKLVPLERGVHNLRRLLDLEEE
Ga0196883_10002844F010091N/AMKPMIDIEQLLTEAETGKVNRVSERITDEAKPFWNGIEERVLAGRPIKPFVVSRLLKEHYGIKISETAIRNHFAHLIDNAE
Ga0196883_10002847F037248AGGAGMTMPNEMRASVPPSPQNNRKGKSPTLLTNDKVKILLSSPNTWYIIGTKDKWISGVKANIESMTQKNISQLKDKGKFEIVQRKNDLGTIDIYCQWIPNEEII

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.