NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196883_1003233

Scaffold Ga0196883_1003233


Overview

Basic Information
Taxon OID3300022050 Open in IMG/M
Scaffold IDGa0196883_1003233 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1852
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Belliella → unclassified Belliella → Belliella sp. DSM 107340(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.12Long. (o)-75.25Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036720Metagenome / Metatranscriptome169N
F060933Metagenome / Metatranscriptome132N
F068898Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0196883_10032332F068898AGTAGMIASKAEIKALAFSNTFDINAVKDNLIQLVEWEQVLSLFGADFYDDVVANPASYTTLIGTYLKPYIAYNVKAYLSKANHIKTGNKGAQTAQGSNEQIANVEFAKREAMNMATKYKRQMITYLDNTKPTLWKGEPKDDQIINKIIIM
Ga0196883_10032333F036720N/AMDSIYVTNYFTNGIESSFILAAFFFLLLAFVTSKWFQFTIRDIESERTPLEVSWKFWWLDNYNSVISFFLMCFPIIVFTEDLVHWLGLNFLPDAMKTENPMYIYYIFGLSFGWVLEVILKKAKLIRNAQK
Ga0196883_10032334F060933AGGMDKVILGAILLIQSLQTESFKNKIVDVCLTISTGMGVYFTLPFQISTNFYAQEIFRSITSIFTAITILVISLFIRRWWSKRFK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.