NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212030_1000628

Scaffold Ga0212030_1000628


Overview

Basic Information
Taxon OID3300022053 Open in IMG/M
Scaffold IDGa0212030_1000628 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2756
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)37.1Long. (o)-76.0972Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026437Metagenome / Metatranscriptome198Y
F064194Metagenome / Metatranscriptome129N
F093803Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0212030_100062810F064194AGGMRTYLVEINAVVWKQIEVRAESVEAADKLAHELFDLATDGCPEWISLRYDQETKMIWEDDSPNIRNWKEVM
Ga0212030_10006284F093803GGAGGMSKVPEGFQDWSLDEKSAYWDKQREKDCACRQKGIDKLSQEQRDAVKEAYDAISSAMMSLHECQDLWMSDVKKLDDSMWQLRRQFNLEGSDD
Ga0212030_10006286F026437AGGAGGMKYYIGNIDEQYGEFEVEQTFLFATAGDPDQVMEELAKDWYGLDEHDSDGLPEGMYWNGGMAYGAGRHYEVTKATYDELKDKRVFTEIWREN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.