NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224906_1000938

Scaffold Ga0224906_1000938


Overview

Basic Information
Taxon OID3300022074 Open in IMG/M
Scaffold IDGa0224906_1000938 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15154
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (52.38%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000499Metagenome / Metatranscriptome1074Y
F012837Metagenome / Metatranscriptome277Y

Sequences

Protein IDFamilyRBSSequence
Ga0224906_10009384F012837GGAGMPGSLVFYPTTDEHLVKIKEQYKDAGNMVKLADFIIKNRNDIKFRFQDRKAIFYTNYDKSLILIDNFWDYWISSKSVDPKMTTLSKNVVGCNRLPHGKYKYQVYLKKDAHLHIDDTQKKNLYEFIERNTDHCLLTQWALIDWFEDKCQYCFGGYFYVTEEQFITPIYMMAQQAIDKVITYRKVKNGSNKKVKR
Ga0224906_10009389F000499AGGAMQKDIYKEDYFGTLMCILVDESRRIMPTFNPTPELQKIQADMCAAGDWLPEVPVGTIIWSEPQQFIKELQQKVLPEYRRLAAHLIDRFIGEFEAQGGRKIEITEKLESMYIWKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.