NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224906_1001013

Scaffold Ga0224906_1001013


Overview

Basic Information
Taxon OID3300022074 Open in IMG/M
Scaffold IDGa0224906_1001013 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14363
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (80.77%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003637Metagenome / Metatranscriptome476Y
F050424Metagenome145N
F072428Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0224906_100101313F050424GAGGMGIEFENIYKDRIIDTIQKLLKQNLSSIPIMFDEHRGQESFLIVPEADAFVDYASNVHIREFTTTINYQLRKGGEYTKENQLNRLTMIAEVVKRLLFDNRNYESGNITNWYGGQVSSVEYTRDEEDETISNVIITFQCNTNEVIS
Ga0224906_100101319F072428AGGGGGMDLAETIKRMKELSAMLQAKTISDREKEFYLPELHRLIESLEVPQLIGELSNEYIS
Ga0224906_100101325F003637GAGGMAKVIAEKVQEQAQVDSPKMVEIKHTRTMQDASGNDVEVVDYTETISVDEAISRTESRKSELETQLTECEAELADYIAIRDAE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.