NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228536_1000321

Scaffold Ga0228536_1000321


Overview

Basic Information
Taxon OID3300022177 Open in IMG/M
Scaffold IDGa0228536_1000321 Open in IMG/M
Source Dataset NameEnriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)102446
Total Scaffold Genes91 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)82 (90.11%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.4447Long. (o)-76.485Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077462Metagenome / Metatranscriptome117Y
F105449Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0228536_100032112F105449AGGAGGMAVKCVECGKTVLKVNAKNKCEECARKDESMKSYFTRLFFINESCARLVPAT
Ga0228536_100032134F077462AGGGGGMMSAGRLKTGVLITAILILFFGPLAVERTFCDVTRELKKLSEEREKSVGYAKIAKVSFKKQPKKLTHAMLYYTDAKSIGNPIIQQLQTSLASRSMKESQLREMLSEDVKRLVTVNEKFRAFIESGSSSNRALPGLAAVAGMAGPITDACVNLWKEYKDADKKRVDAMVEVLEGYKWADWDKI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.