NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224499_10002109

Scaffold Ga0224499_10002109


Overview

Basic Information
Taxon OID3300022206 Open in IMG/M
Scaffold IDGa0224499_10002109 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5263
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.7Long. (o)-122.34Alt. (m)Depth (m)11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030099Metagenome186N
F033809Metagenome / Metatranscriptome176N

Sequences

Protein IDFamilyRBSSequence
Ga0224499_100021092F030099AGGAGGMTESEHETCKSLAEQLGKPYTAMSIGKLRAAVCSEEDLDGKYILPTGVLKITAQIKGEIKVIEEAAPAIVTVRVLHHQTGNPRFIFAEDPDTRRKVRVSVPKRHKHIINQVGKRLKVNKVDQDGTAYYRYPAI
Ga0224499_100021094F033809AGGAMSEELTIETKNFITKKLRDAQEATGHGRAWCKRDPKRWALVAQHIIQKPNEVSVFLRKNNITKNFYYDVQTELMADPESSEIRNAWASEISSVLFQGLDTYRKSQNSYSDRVESGDIEIDGNELFKQGKSLQAFNDIHSKLTGNNVQRVVVEHKTTLDEAEEYARKMLEGLPEAEIVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.