NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224514_10104639

Scaffold Ga0224514_10104639


Overview

Basic Information
Taxon OID3300022217 Open in IMG/M
Scaffold IDGa0224514_10104639 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)976
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.7Long. (o)-122.34Alt. (m)Depth (m)11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010322Metagenome / Metatranscriptome305N
F068713Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0224514_101046392F010322GGAGMSAVASNTMSEANALMRDMLAITEHTEMPDLAKVYALGAALQSVVGFMRDNDCDVQDAIAMAMGIIFETYSTPDKGDMH
Ga0224514_101046394F068713N/AHDELSVGDLCSMIEQDAVHIDIGLKTMRERRTIIKTSFIEGQQLYRLRTQEEFAF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.