NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0226658_10156996

Scaffold Ga0226658_10156996


Overview

Basic Information
Taxon OID3300022222 Open in IMG/M
Scaffold IDGa0226658_10156996 Open in IMG/M
Source Dataset NameFreshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1044
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Lake Vanda, McMurdo Dry Valleys
CoordinatesLat. (o)-77.5281Long. (o)161.59Alt. (m)Depth (m)19
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043774Metagenome / Metatranscriptome155Y
F058542Metagenome / Metatranscriptome135N

Sequences

Protein IDFamilyRBSSequence
Ga0226658_101569961F058542N/AMSDYIPDPVLWGPQTWEQPADLPRAKQLLGKMHEVKTKALRKEDGFPLAKINGVIQQAHLEWSKLDKEITDHLIAVGDRANATHYMFGHNPNGLPNGDTNKETIQRKKARITIARVMVHNRQKEWIKKKALNLWIEEFLPKG
Ga0226658_101569962F043774N/AQALSFADRHHFDLNLSDLLDKSTQYKRNWLLNVIAARQRFERHQANFEGIQTLSIANSQLIKWMTTGRAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.