NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224507_10058413

Scaffold Ga0224507_10058413


Overview

Basic Information
Taxon OID3300022307 Open in IMG/M
Scaffold IDGa0224507_10058413 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1519
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.03Long. (o)-122.37Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003058Metagenome / Metatranscriptome510Y
F003647Metagenome / Metatranscriptome475Y

Sequences

Protein IDFamilyRBSSequence
Ga0224507_100584131F003647N/ALADVKNRASNKAFAKVTMLKLDIDDYKRSLIDGTYGGITYEEAEQVLEGYKTELKVWNYITELIEKQ
Ga0224507_100584135F003058GAGMTESEMNKLADLVVSKIINRQKAYDEEFKAEIQGMVDDNENLEFGTITEDEIIADEIIKLNNRLDQLEENEDYEAARIVANKIKHLKNKYNL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.