NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224504_10032901

Scaffold Ga0224504_10032901


Overview

Basic Information
Taxon OID3300022308 Open in IMG/M
Scaffold IDGa0224504_10032901 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2034
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.7Long. (o)-122.34Alt. (m)Depth (m)11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043681Metagenome / Metatranscriptome156Y
F044800Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0224504_100329013F043681GGAMALTYENITYEKIMTPLRDKLRTEFKGGLPIYFDNQHQDIGTKSLRIYPTSQELVEKRTKSYINVYNIQMDYVLKTYRDDEKALDQMYKDVTRIETILFNNSNGGDIPYFYAGMPEVEHNVDAGIDNVYVSRITVPVLYEESHEQFVRFITSNDKFFVTSDGLFYIVRS
Ga0224504_100329014F044800GAGGMAVASTNAWKVNVEETIQKGVKNEFFTSLPVFRSRDFQHRGNQFCIIKGIDSDAQNTMFQVLPNNYNLTLEFFMLDQKRNDITIKKFFSTVSRIEELFYTLVDLDPLFSCTINGIDYADDIEFNGYRKATFDITVGNVR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.