NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224510_10510157

Scaffold Ga0224510_10510157


Overview

Basic Information
Taxon OID3300022309 Open in IMG/M
Scaffold IDGa0224510_10510157 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)715
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.05Long. (o)-121.934Alt. (m)Depth (m)11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045180Metagenome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0224510_105101571F045180N/APELTWSELAAFFVGWLVVAQAVFHLARRQRSVDTFLVVIAVVLVGRTFTSGNTLAVAELAAIALLLPVLVLMSRIEDRGRSALIAAALGTWLVAVALAPVLAESHRAVAELPEVGEYLRRNAPPASQLAGKAFSYVALAWLLAGTGLLPHVAAGVTVLFVLLLGLLHVGAVAPAYGWIDLVIAMIAGFMITRWMPRGAGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.