NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0242656_1026489

Scaffold Ga0242656_1026489


Overview

Basic Information
Taxon OID3300022525 Open in IMG/M
Scaffold IDGa0242656_1026489 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)902
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010901Metagenome / Metatranscriptome297Y
F031614Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0242656_10264891F031614N/AVLFDSFLHPVFEGARSASAGTRQMLYRADPFQIDIQVEPKPGANRIVVTGQLLDLSNPGIIGRDARIVLSNMRGQVVHAVTNQFGEFSGEIENSGDLQMTFAAPGSQPIVISLRDALGTLPEDVQ
Ga0242656_10264892F010901GGAMKRSALVVALLVLMLSAAKPAAAQNRYIVRSTGGLSSVLNLCNLLGCQVQGGLDGPLGQNFLVTSSNNLLANLLNGTLTFVESLLGIVSVEADRLLPIPHAGPGSIPS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.