Basic Information | |
---|---|
Taxon OID | 3300022543 Open in IMG/M |
Scaffold ID | Ga0212119_1012299 Open in IMG/M |
Source Dataset Name | Indian_combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1591 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Indian Creek, Illinois | |||||||
Coordinates | Lat. (o) | 41.6655 | Long. (o) | -87.5437 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039634 | Metagenome / Metatranscriptome | 163 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212119_10122992 | F039634 | N/A | MKLNFKMYNTLPTKKSHWWQVVLFPTVSVMNNIQKYDPYVAVNAEYLFWSFTTIISYGKKGQHPYITR |
⦗Top⦘ |