NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212119_1012640

Scaffold Ga0212119_1012640


Overview

Basic Information
Taxon OID3300022543 Open in IMG/M
Scaffold IDGa0212119_1012640 Open in IMG/M
Source Dataset NameIndian_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1560
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049561Metagenome / Metatranscriptome146N
F096905Metagenome / Metatranscriptome104N
F098924Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0212119_10126401F049561AGGAGGMTKIRVELEETDLFNAVKKIIDHPNRVEIAKVLTSIIAPHEKVSSIFFKTYFGGAAPQVLPEGTMITVNPNRLSYKTNVDGMKRIGLLNISGHATAIIKEFRGFHESHNYYVNFMNVDDNDKSYED
Ga0212119_10126402F096905N/AMESKIFTSVIGFDFKLDLVDNDGQPIKTGARRIDYLSSETPNVGTKIGGESWFTNFNEPLLNKIRDYRRRND
Ga0212119_10126403F098924N/AMLGKLFNRKKTYPKDNRFEVLIIGEDKTDFQEMLGITDKRKDELLKLAFKSYKDHELYTTSCKVAVAECTHINEVVFLMTMLTKIRELESNPLSSLLSHLTHGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.