Scaffold Ga0212092_1189226

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212092_1189226

Scaffold Ga0212092_1189226

Overview

Basic Information
Taxon OID	3300022548 Open in IMG/M
Scaffold ID	Ga0212092_1189226 Open in IMG/M
Source Dataset Name	Cone Pool_combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	769
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	37.4127	Long. (^o)	-118.504	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017748	Metagenome	239	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212092_11892262	F017748	N/A	LTMFPALSLLAQLRCSPSASGNVNCWDAQKGGAPVLKVEPYLFGGYDLRQSDGKLVRCEKKASGETECRVVQEGRKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.