NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212089_10000219

Scaffold Ga0212089_10000219


Overview

Basic Information
Taxon OID3300022551 Open in IMG/M
Scaffold IDGa0212089_10000219 Open in IMG/M
Source Dataset NameBoni_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)39968
Total Scaffold Genes35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameIndonesia: Gulf of Boni
CoordinatesLat. (o)-2.75Long. (o)121.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008012Metagenome / Metatranscriptome340Y
F083517Metagenome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0212089_1000021925F008012GAGMDKAIVSAGILLVLAGLVGIVYGLGINVTAMMARGATDYSFITAYITEWTLILIAGIVMIVAGVRRK
Ga0212089_1000021933F083517N/AMPPEYIAALKAFAFQGDVSLAEYVRGMAYDEILKKGASFRERGASFRALISTGEAWVMDYHQCVAVAGGLPGKERRTELERLTWEAAKNERHRMLAIQAIALITRAEEEILADMDKAEADQIVRRIEAASNVMYKAAGHDPTKTARSK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.