NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212123_10004794

Scaffold Ga0212123_10004794


Overview

Basic Information
Taxon OID3300022557 Open in IMG/M
Scaffold IDGa0212123_10004794 Open in IMG/M
Source Dataset NamePaint Pots_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25015
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: Banff, British Columbia
CoordinatesLat. (o)51.1699Long. (o)-116.1578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000065Metagenome / Metatranscriptome2788Y
F002000Metagenome / Metatranscriptome606Y
F024597Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0212123_1000479415F002000GGAMTNQLQLISGYLEMEVYPKALGKTKETMKELHTLATSLTGLADVGMTVPKDGAVVVPHGSTVVSHEDVNVDVDRNEVRSIDKNEVRAGYGEDNPKTK
Ga0212123_1000479416F024597GAGMKRNSRIGILTLTTLWLCFVVQLGLAFGLAGLFWPDKFMPLFETLMFPWAASRSAIRANGIAALGLSLLLLVTRLMGNR
Ga0212123_100047948F000065GAGGMIHGAKKPTPKLRRALQPPLSHPGAIPDSDRAKKPPLGETRATNQELEPGDRVEGLGNFGTPTGEIGTVERANEEDAVVKWDDDGRTRLHQPSLKRI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.