NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212128_10017767

Scaffold Ga0212128_10017767


Overview

Basic Information
Taxon OID3300022563 Open in IMG/M
Scaffold IDGa0212128_10017767 Open in IMG/M
Source Dataset NameOV2_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4558
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameBeatty, NV
CoordinatesLat. (o)36.96Long. (o)-116.72Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006542Metagenome / Metatranscriptome370Y
F039568Metagenome / Metatranscriptome163Y

Sequences

Protein IDFamilyRBSSequence
Ga0212128_100177671F006542AGGVDETELSELLTASGFFRFLAQQARLDSDEIKRIYMLGRPWGLWPPDLDISHEAAEIGVDVFTYLAALQPLLDMDAKEKEAQLTAYEATLTGGETTPLIPAVRARVERIAASSKEDEATICRILHALYAYRQRVGRLSIQKVGASSRHKMEQD
Ga0212128_100177672F039568GAGMAQEPFQAVANTPGFVTFAKCFCINPVYINPVFGGGRYKKRKGWVLIDLATRAETNFKTLRDARSHLMCLYMATTPKISPAEGF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.