NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212128_10172839

Scaffold Ga0212128_10172839


Overview

Basic Information
Taxon OID3300022563 Open in IMG/M
Scaffold IDGa0212128_10172839 Open in IMG/M
Source Dataset NameOV2_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1385
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameBeatty, NV
CoordinatesLat. (o)36.96Long. (o)-116.72Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004359Metagenome / Metatranscriptome442Y
F093332Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0212128_101728392F004359AGGAMYEHFERLFQGLAPTPDHLKRAYYELADDFFRKLRQQIEVTQNELREGEQLEVYYASQGDERLLVSRIAYVEPLLLVLYGKDDHNNDCKVLGNLLTVHLTLRLVRNGAPEKHRIISFVEPAKGVPQG
Ga0212128_101728393F093332GGAMFLAQQAADAKAAVRRTMADIKATAQEVADVRWWTQHYPWYAVGTAAVVGFITATQALAPADQHAQTAPPSQGPPAARPSWMASLFELVRSTLLSMVVEFLHSRSQQAGRAQTQADSSLD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.