Scaffold Ga0236341_1000254

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0236341_1000254

Scaffold Ga0236341_1000254

Overview

Basic Information
Taxon OID	3300022591 Open in IMG/M
Scaffold ID	Ga0236341_1000254 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Laval University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	33921
Total Scaffold Genes	54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	51 (94.44%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location Name	SAS2a, Kuujjuarapick, Canada
Coordinates	Lat. (^o)	55.1491	Long. (^o)	-77.4866	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057196	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0236341_100025437	F057196	AGGAG	MNVIYKSKSQVRNETADAVAKFLKSGGTIEVVKARKAPKQLMRGKTTRVASTGTSGFAVGYPRKSGI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.