NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0236337_1189597

Scaffold Ga0236337_1189597


Overview

Basic Information
Taxon OID3300022653 Open in IMG/M
Scaffold IDGa0236337_1189597 Open in IMG/M
Source Dataset NameFreshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLaval University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)644
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location NameSAS2a, Kuujjuarapick, Canada
CoordinatesLat. (o)55.1491Long. (o)-77.4866Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023003Metagenome212N

Sequences

Protein IDFamilyRBSSequence
Ga0236337_11895972F023003N/AAPDGADIGALADTLVDRGRAVLDQFPAVADSARDILAGAQDQVNGLSDMGIVAASGFALGVSSGLLLAGAPRAILILSMIPVALTLRSAFARGMRPARLLN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.