NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214917_10001976

Scaffold Ga0214917_10001976


Overview

Basic Information
Taxon OID3300022752 Open in IMG/M
Scaffold IDGa0214917_10001976 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25654
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)40 (85.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012108Metagenome / Metatranscriptome283Y
F037567Metagenome / Metatranscriptome167N
F064189Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0214917_1000197643F037567GAGMEWISFFGPRRPINGQKVYYFGPDIGVWQGRYEIHRDDPVSEHILICEESPGIVDRMDAPWWMPYEGQKKPQRPETDYPKDYPHG
Ga0214917_1000197644F064189AGGAMAKNFKDLHTVDAKDMTRDQAMIYIINFFNSRISAMSNANINKVKELIGLHEIATSELVNKYVELVLENS
Ga0214917_1000197646F012108AGGMINLQLSVREAMELSFYAREDIRERITQAFEMALGVNQRCTVTITNGMTLDNRIHCIKAIRLHTGWGLKESKDWTDVLVGGWKNDRFVPAQNGIKQSITLKTPEAAENLLRDLADLGCEGYLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.