Scaffold Ga0233429

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0233429_1300404

Overview

Basic Information
Taxon OID	3300022902 Open in IMG/M
Scaffold ID	Ga0233429_1300404 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Restricted
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components
Scaffold Length (bps)	525
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location Name	Canada: British Columbia
Coordinates	Lat. (^o)	48.5847	Long. (^o)	-123.5008	Alt. (m)	Depth (m)	135
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041190	Metagenome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233429_13004041	F041190	N/A	MNAKDLELKISGLQKAIEEKTADASRFQDELKTTQKKLEDINKPEITPMQFDLIQEAIERGVDEFDFSDTGNFDIEYGIEYDGKVHCESHDLNETHELVEMITSRVHKLFTEAECPTEEE

⦗Top⦘

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.