Scaffold Ga0233356_1000019

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0233356_1000019

Scaffold Ga0233356_1000019

Overview

Basic Information
Taxon OID	3300023046 Open in IMG/M
Scaffold ID	Ga0233356_1000019 Open in IMG/M
Source Dataset Name	Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	83272
Total Scaffold Genes	72 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	45 (62.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	40.282	Long. (^o)	-123.2869	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019376	Metagenome / Metatranscriptome	230	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233356_100001957	F019376	GGAGG	MKDLKHVSRLTTRSPLRSVSLQIREYQVTVKVKTPVPQARPTSARWLAR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.