NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136601_1002915

Scaffold Ga0136601_1002915


Overview

Basic Information
Taxon OID3300023049 Open in IMG/M
Scaffold IDGa0136601_1002915 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #699
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4479
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Rauer Islands
CoordinatesLat. (o)-68.5558Long. (o)78.1913Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022145Metagenome215Y
F034486Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0136601_10029153F022145N/AMAMTATELKKKDYTIQVGYSKKAKKEKLLKFISKSGDTFEISADEMSSILINQVNSNTLAATFVQSDRINVVEVGRQLECVLDKDMKAGEKIRINYTHPYPLEFALIEEAAKTAKINEDAPTITLTKEYLDDFKKKLQPEMTEYIEKFYKSFKNLKEKED
Ga0136601_10029154F034486AGGMDENEQSIRQKKIALAQSEHAPIIIELMKDCMEKVPDLIDDTQWKTVVHAIRLDVQGKMLTTMVDHLEGIRQGKLHTDEDNKQK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.