Scaffold Ga0136601_1035263

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136601_1035263

Scaffold Ga0136601_1035263

Overview

Basic Information
Taxon OID	3300023049 Open in IMG/M
Scaffold ID	Ga0136601_1035263 Open in IMG/M
Source Dataset Name	Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #699
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	692
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Rauer Islands
Coordinates	Lat. (^o)	-68.5558	Long. (^o)	78.1913	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013488	Metagenome	270	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136601_10352631	F013488	N/A	VSMSGKLVRLEQPNHVFTKTVPEDVSIKGKLVRLLQPRHACKKLVPEDVSMSGKLVRLLQTSHALVKSVPEDVSMSGKLVRLEQLCHASRKLFPADVSIKGKLVRLEQPTHARSKSVPEDVSIRGKLVRLEQFSQARKKLVPEDVSMSGKLVRLVQFCQVWLKLVPADVSMSGKLVRLLQPHQAR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.