NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224554_1000276

Scaffold Ga0224554_1000276


Overview

Basic Information
Taxon OID3300023068 Open in IMG/M
Scaffold IDGa0224554_1000276 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)45497
Total Scaffold Genes45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)33 (73.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0474Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020214Metagenome / Metatranscriptome225Y
F027359Metagenome / Metatranscriptome195Y
F051570Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0224554_100027611F051570N/AMSLSDLIRKGFGYVLLSMGVSRPAPRPKPESKPEPKSDSGGQSK
Ga0224554_100027615F027359GGAGGVSTQLLHAPLDLATIGPASRYIRETRDELLTYETEDLAAVRFSIILTARWADSDDETPERRAELRGELDLLRKHYGDKIDEIAMTFGVQQAMQTRDEVERTVIVPVEVKPIANPKRGAKHREYSEEDLGL
Ga0224554_100027641F020214GGAGGMTIRKAPSFALVCAPMLIWAQAAGGHLDGTWTTNMSCDASTHMPAFTWTFVSTIANGNFHGQHGEEGGPGYLVIDGTIGAGGSAKLHAKGTVQAGKAGFVTQLKGNKYDYYIDATFTDTSGTGKREEGAGILGRPCSFDFTKQTGADTTPAGSSTGSVTPPPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.