NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255774_10205974

Scaffold Ga0255774_10205974


Overview

Basic Information
Taxon OID3300023087 Open in IMG/M
Scaffold IDGa0255774_10205974 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1014
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040951Metagenome / Metatranscriptome160Y
F044932Metagenome / Metatranscriptome153N

Sequences

Protein IDFamilyRBSSequence
Ga0255774_102059742F044932GGAMKKITLLTLATFFSLQTLSNINEIDEERVWNVKNIDNEFIWYRVPGQTVWGHKYGFIKNSSNCDADNFVIEWSSYENMKKYEGKIIPLQLENNKGQITRIKPYLSYVNNFTDIMQVGFFTDDQSHTTSTKTFDIFNNDSDTVTISIGDEYENFDIKSDTFLTRGLKEARKKAAIKCRGLSSNFALKAV
Ga0255774_102059743F040951AGGMIISYEEPPNRKHFDSEEEYQKAFEEWKEVFDSILEKHGNFGGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.