NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255784_10037618

Scaffold Ga0255784_10037618


Overview

Basic Information
Taxon OID3300023108 Open in IMG/M
Scaffold IDGa0255784_10037618 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2993
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium MBRS-H7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033271Metagenome / Metatranscriptome177N
F044932Metagenome / Metatranscriptome153N
F062407Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
Ga0255784_100376181F062407N/AMNKQKNLYRLKPLKRKLRGLGFVLDDYATCVDKKEVSFNYPYVYLGMALCYAGFFFVDKYHGILFSNPF
Ga0255784_100376183F033271AGGAMKKNIYLLSLLFLLSMKSYSSSETFEENYACGVDMYMLSSIFRLSTEKSDNLELKNAAIREHILWEKVNLSLLSERELDIAKRKERLKSDMIKRLTSLHEERGLENILTENFIDEATDGCFGDTKIQKVYNLYYAGMKNG
Ga0255784_100376185F044932N/AMKKITLLLTAIFSLQALSNINEIDKERVWDVKNIDNEFIWYRVPGQVVWGHKYGFIKNPLNCDSDNFVIEWSSYEDIKKYEGKIITLELENNKGQKTQIKPYLNYVQNFTNIMQVGFFSDDQSHTTTSNAFDVFNNESETITISISDDYESFDIKSDTFFTKGLQDARKKAALKCRSLSSNFTLLTT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.