NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214923_10002263

Scaffold Ga0214923_10002263


Overview

Basic Information
Taxon OID3300023179 Open in IMG/M
Scaffold IDGa0214923_10002263 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25879
Total Scaffold Genes72 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)50 (69.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008812Metagenome / Metatranscriptome327Y
F056376Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0214923_1000226318F008812AGGAGMIQWIGVLLAVMGLAYNGIKDYQKGEIKLPTLPQKQQLTKPVYPIQYCLMAYDPNLDKVFYLHENGRWFDYAPPQRRYSTSTQYNQDQNQATVATAYGTSGGSGQYYVRQ
Ga0214923_1000226343F056376GGAMTLIKCFSNVIGHKEAQELVVDLNQMKSSQSDPFYIKYDKYQDYSKDNNYLVVGNVTQKDWDELNLDMDFMEADII

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.